PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.J202900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family HD-ZIP
Protein Properties Length: 224aa    MW: 24183.1 Da    PI: 9.3984
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.J202900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox54.91.4e-17112164254
                        T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
           Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                        rk+ ++tkeq   Le+ F+++++++ +++  LAk+l+L  rqV vWFqNrRa 
  Pavir.J202900.1.p 112 RKKLRLTKEQSALLEDRFKEHSTLNPKQKVALAKQLNLRPRQVEVWFQNRRAS 164
                        788899*********************************************96 PP

2HD-ZIP_I/II116.31.8e-37112205191
        HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRA....RtktkqlEkdyeaLkraydalkeenerLekeveeLr 88 
                        +kk+rl+keq++lLE+ F+e+++L+p++Kv+la++L+l+prqv+vWFqnrRA    Rtk+kq+E+d+e+Lkr++++l+een+rL++e +eLr
  Pavir.J202900.1.p 112 RKKLRLTKEQSALLEDRFKEHSTLNPKQKVALAKQLNLRPRQVEVWFQNRRAsrarRTKLKQTEVDCEFLKRCCESLTEENRRLQRELQELR 203
                        69*************************************************988889**********************************9 PP

        HD-ZIP_I/II  89 eel 91 
                         +l
  Pavir.J202900.1.p 204 -AL 205
                        .55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.6E-1799162IPR009057Homeodomain-like
SuperFamilySSF466894.05E-17105164IPR009057Homeodomain-like
PROSITE profilePS5007116.52108168IPR001356Homeobox domain
SMARTSM003891.2E-14110172IPR001356Homeobox domain
CDDcd000866.99E-15112170No hitNo description
PfamPF000465.8E-15112164IPR001356Homeobox domain
CDDcd146860.00808159204No hitNo description
SMARTSM003401.2E-23172215IPR003106Leucine zipper, homeobox-associated
PfamPF021832.4E-11172206IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 224 aa     Download sequence    Send to blast
MAQEDVHLDD AGLALDLSLG GGGASDAARR QGTGGRLGRD AARLPPSPRA LEPSLTLSMP  60
DEATATGSGG GAAHSVSSPP AAGVKRERVE EADGERASST ARAEDDDDGS TRKKLRLTKE  120
QSALLEDRFK EHSTLNPKQK VALAKQLNLR PRQVEVWFQN RRASRARRTK LKQTEVDCEF  180
LKRCCESLTE ENRRLQRELQ ELRALKFAPP GPGPPPPPAT APAP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1110116TRKKLRL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004985118.16e-97PREDICTED: homeobox-leucine zipper protein HOX19 isoform X1
SwissprotA2XE765e-76HOX19_ORYSI; Homeobox-leucine zipper protein HOX19
SwissprotQ8GRL45e-76HOX19_ORYSJ; Homeobox-leucine zipper protein HOX19
TrEMBLA0A096S3014e-88A0A096S301_MAIZE; Uncharacterized protein
STRINGGRMZM2G126808_P021e-87(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20553698
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.14e-46homeobox from Arabidopsis thaliana